1 2

EvoX Biolabs Research Peptides

LL-37

LL-37

$99.00 USD
$99.00 USD
Sale Sold out
Weight
Quantity

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

  • Sequence: [LL-37, 37 aa]
  • Molecular Weight: 4493.33 g/mol
  • Purity: >95%
  • Available in 10mg vials

Research Applications:

  • Antimicrobial mechanism studies
  • Innate immunity investigations
  • Wound healing research
  • Anti-biofilm activity analysis

Why Source LL-37 From Us?

  • Rigorous quality control ensures consistent purity
  • Comprehensive documentation, including certificates of analysis
  • Competitive pricing for research budgets
  • Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.
View full details